ELISA Recombinant Mouse Complement receptor type 2(Cr2),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Immunology Uniprot ID: P19070 Gene Names: Cr2 Organism: Mus muscµLus (Mouse) AA Sequence: LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW Expression Region: 729-963aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 28 kDa Alternative Name(s): Complement C3d receptor CD_antigen: CD21 Relevance: Receptor for complement C3d. Participates in B lymphocytes activation. Reference: "A molecµLar and immunochemical characterization of mouse CR2. Evidence for a single gene model of mouse complement receptors 1 and 2." Molina H., Kinoshita T., Inoue K., Carel J.-C., Holers V.M.J. Immunol. 145:2974-2983(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.