Se rendre au contenu

ELISA Recombinant Mouse Complement receptor type 2(Cr2),partial

https://assay.labm.com/web/image/product.template/144233/image_1920?unique=2109108
(0 avis)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Immunology Uniprot ID: P19070 Gene Names: Cr2 Organism: Mus muscµLus (Mouse) AA Sequence: LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW Expression Region: 729-963aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 28 kDa Alternative Name(s): Complement C3d receptor CD_antigen: CD21 Relevance: Receptor for complement C3d. Participates in B lymphocytes activation. Reference: "A molecµLar and immunochemical characterization of mouse CR2. Evidence for a single gene model of mouse complement receptors 1 and 2." Molina H., Kinoshita T., Inoue K., Carel J.-C., Holers V.M.J. Immunol. 145:2974-2983(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

904,00 € 904.0 EUR 904,00 € Hors taxes

904,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-YP005934MO
URL de site web: /shop/csb-yp005934mo-elisa-recombinant-mouse-complement-receptor-type-2-cr2-partial-144233

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.