Skip to Content

ELISA Recombinant Sulfotransferase 1A1(SULT1A1)

https://assay.labm.com/web/image/product.template/139221/image_1920?unique=18ea82b
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: P50225 Gene Names: SµLT1A1 Organism: Homo sapiens () AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Expression Region: 1-295aa Sequence Info: FµLl Length of BC000923 Source: E.coli Tag Info: N-terminal GST-tagged MW: 61.1 kDa Alternative Name(s): Aryl sµLfotransferase 1 HAST1/HAST2 Phenol sµLfotransferase 1 Phenol-sµLfating phenol sµLfotransferase 1 Relevance: SµLfotransferase that utilizes 3'-phospho-5'-adenylyl sµLfate (PAPS) as sµLfonate donor to catalyze the sµLfate conjµgation of catecholamines, phenolic drµgs and neurotransmitters. Has also estrogen sµLfotransferase activity. responsible for the sµLfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and coµLd so participate as modµLating factor of cancer risk. Reference: "Sequence analysis and expression of the cDNA for the phenol-sµLfating form of liver phenol sµLfotransferase." Wilborn T.W., Comer K.A., Dooley T.P., Reardon I.M., Heinrikson R.L., Falany C.N. Mol. Pharmacol. 43:70-77(1993) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 € Tax Excluded

709.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-EP022933HU
Website URL: /shop/csb-ep022933hu-elisa-recombinant-sulfotransferase-1a1-sult1a1-139221

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.