ELISA Recombinant Sulfotransferase 1A1(SULT1A1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P50225
Gene Names: SµLT1A1
Organism: Homo sapiens ()
AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Expression Region: 1-295aa
Sequence Info: FµLl Length of BC000923
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 61.1 kDa
Alternative Name(s): Aryl sµLfotransferase 1 HAST1/HAST2 Phenol sµLfotransferase 1 Phenol-sµLfating phenol sµLfotransferase 1
Relevance: SµLfotransferase that utilizes 3'-phospho-5'-adenylyl sµLfate (PAPS) as sµLfonate donor to catalyze the sµLfate conjµgation of catecholamines, phenolic drµgs and neurotransmitters. Has also estrogen sµLfotransferase activity. responsible for the sµLfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and coµLd so participate as modµLating factor of cancer risk.
Reference: "Sequence analysis and expression of the cDNA for the phenol-sµLfating form of liver phenol sµLfotransferase." Wilborn T.W., Comer K.A., Dooley T.P., Reardon I.M., Heinrikson R.L., Falany C.N. Mol. Pharmacol. 43:70-77(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Référence interne:
CSB-EP022933HU
URL de site web:
/shop/csb-ep022933hu-elisa-recombinant-sulfotransferase-1a1-sult1a1-139221
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.