ELISA Recombinant Mouse Serum amyloid A-1 protein(Saa1)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: Saa1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus muscµLus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P05366
AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-122aa
Protein length: FµLl Length of Mature Protein
MW: 27.8 kDa
Alternative Name(s):
Relevance: Major acute phase protein
Reference: "Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences."Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-EP020656MO
Website URL:
/shop/csb-ep020656mo-elisa-recombinant-mouse-serum-amyloid-a-1-protein-saa1-146104
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.