ELISA Recombinant Mouse Serum amyloid A-1 protein(Saa1)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: Others Target / Protein: Saa1 Biologically active: Not Tested Expression system: E.coli Species of origin: Mus muscµLus (Mouse) Delivery time: 3-7 business days Uniprot ID: P05366 AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 20-122aa Protein length: FµLl Length of Mature Protein MW: 27.8 kDa Alternative Name(s): Relevance: Major acute phase protein Reference: "Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences."Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.