Skip to Content

ELISA Recombinant Arabidopsis thaliana Glucomannan 4-beta-mannosyltransferase 9(CSLA9)

https://assay.labm.com/web/image/product.template/116706/image_1920?unique=7f7b80c
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9LZR3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELGDTTSVIPDSFMGYRDDITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVmLFVERV YMGIVISLVKLFGRKPDKRFKYEPIKDDIELGNSAYPMVLIQIPMFNEREVYQLSIGAAC GLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGM KKSYVKSCDYVAIFDADFQPEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQE MSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKG WKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIY SFFVVRKLVAHIVTFIFYCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLM VFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDVKAKSATKTSKKVIRFRFGDR IHVLELGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPNH Protein Names:Recommended name: Glucomannan 4-beta-mannosyltransferase 9 EC= 2.4.1.32 Alternative name(s): CellµLose synthase-like protein A9 Short name= AtCslA9 Glucomannan synthase Mannan synthase 9 Protein RESISTANT TO AGROBACTERIUM Gene Names:Name:CSLA9 Synonyms:RAT4 Ordered Locus Names:At5g03760 ORF Names:F17C15.180 Expression Region:1-533 Sequence Info:fµLl length protein

1,898.00 € 1898.0 EUR 1,898.00 € Tax Excluded

1,898.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF878648DOA
Website URL: /shop/csb-cf878648doa-elisa-recombinant-arabidopsis-thaliana-glucomannan-4-beta-mannosyltransferase-9-csla9-116706

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.