Se rendre au contenu

ELISA Recombinant Arabidopsis thaliana Glucomannan 4-beta-mannosyltransferase 9(CSLA9)

https://assay.labm.com/web/image/product.template/116706/image_1920?unique=7f7b80c
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9LZR3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELGDTTSVIPDSFMGYRDDITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVmLFVERV YMGIVISLVKLFGRKPDKRFKYEPIKDDIELGNSAYPMVLIQIPMFNEREVYQLSIGAAC GLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGM KKSYVKSCDYVAIFDADFQPEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQE MSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKG WKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIY SFFVVRKLVAHIVTFIFYCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLM VFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDVKAKSATKTSKKVIRFRFGDR IHVLELGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPNH Protein Names:Recommended name: Glucomannan 4-beta-mannosyltransferase 9 EC= 2.4.1.32 Alternative name(s): CellµLose synthase-like protein A9 Short name= AtCslA9 Glucomannan synthase Mannan synthase 9 Protein RESISTANT TO AGROBACTERIUM Gene Names:Name:CSLA9 Synonyms:RAT4 Ordered Locus Names:At5g03760 ORF Names:F17C15.180 Expression Region:1-533 Sequence Info:fµLl length protein

1.898,00 € 1898.0 EUR 1.898,00 € Hors taxes

1.898,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.

Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF878648DOA
URL de site web: /shop/csb-cf878648doa-elisa-recombinant-arabidopsis-thaliana-glucomannan-4-beta-mannosyltransferase-9-csla9-116706

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.