ELISA Recombinant Arabidopsis thaliana Bax inhibitor 1(BI-1)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LD45
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLW NIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILI TAFVGTAIAFVCFSAAAmLARRREYLYLGGLLSSGLSmLMWLQFASSIFGGSASIFKFEL YFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIImLKNSADKEE KKKKRRN
Protein Names:Recommended name: Bax inhibitor 1 Short name= AtBI-1 Short name= BI-1
Gene Names:Name:BI-1 Ordered Locus Names:At5g47120 ORF Names:K14A3.7
Expression Region:1-247
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF873243DOA
Website URL:
/shop/csb-cf873243doa-elisa-recombinant-arabidopsis-thaliana-bax-inhibitor-1-bi-1-116529
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.