ELISA Recombinant Arabidopsis thaliana Bax inhibitor 1(BI-1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9LD45 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLW NIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILI TAFVGTAIAFVCFSAAAmLARRREYLYLGGLLSSGLSmLMWLQFASSIFGGSASIFKFEL YFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIImLKNSADKEE KKKKRRN Protein Names:Recommended name: Bax inhibitor 1 Short name= AtBI-1 Short name= BI-1 Gene Names:Name:BI-1 Ordered Locus Names:At5g47120 ORF Names:K14A3.7 Expression Region:1-247 Sequence Info:fµLl length protein