Skip to Content

ELISA Recombinant Oryza sativa subsp. japonica Aquaporin PIP 1-3(PIP1-3)

https://assay.labm.com/web/image/product.template/148413/image_1920?unique=90f0e4f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryza sativa subsp. japonica (Rice) Uniprot NO.:Q9SXF8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGKEEDVRLGANRYTERQPIGTAAQGAEEKDYREPPAAPVFEVEELTSWSFYRAGIAEF VATFLFLYISILTVMGVNKSASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT FGLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGL GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR SLGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPFKSRD Protein Names:Recommended name: Aquaporin PIP 1-3 Alternative name(s): OsPIP1;3 Plasma membrane intrinsic protein 1-3 Water channel protein RWC3 Short name= RWC-3 Gene Names:Name:PIP1-3 Synonyms:RWC3 Ordered Locus Names:Os02g0823100, LOC_Os02g57720 ORF Names:OJ1136_C04.6, OsJ_008613 Expression Region:1-288 Sequence Info:fµLl length protein

1,639.00 € 1639.0 EUR 1,639.00 € Tax Excluded

1,639.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF866014OFG
Website URL: /shop/csb-cf866014ofg-elisa-recombinant-oryza-sativa-subsp-japonica-aquaporin-pip-1-3-pip1-3-148413

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.