Se rendre au contenu

ELISA Recombinant Oryza sativa subsp. japonica Aquaporin PIP 1-3(PIP1-3)

https://assay.labm.com/web/image/product.template/148413/image_1920?unique=90f0e4f
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryza sativa subsp. japonica (Rice) Uniprot NO.:Q9SXF8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGKEEDVRLGANRYTERQPIGTAAQGAEEKDYREPPAAPVFEVEELTSWSFYRAGIAEF VATFLFLYISILTVMGVNKSASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT FGLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGL GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR SLGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPFKSRD Protein Names:Recommended name: Aquaporin PIP 1-3 Alternative name(s): OsPIP1;3 Plasma membrane intrinsic protein 1-3 Water channel protein RWC3 Short name= RWC-3 Gene Names:Name:PIP1-3 Synonyms:RWC3 Ordered Locus Names:Os02g0823100, LOC_Os02g57720 ORF Names:OJ1136_C04.6, OsJ_008613 Expression Region:1-288 Sequence Info:fµLl length protein

1.639,00 € 1639.0 EUR 1.639,00 € Hors taxes

1.639,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF866014OFG
URL de site web: /shop/csb-cf866014ofg-elisa-recombinant-oryza-sativa-subsp-japonica-aquaporin-pip-1-3-pip1-3-148413

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.