ELISA Recombinant Oryza sativa subsp. japonica Aquaporin PIP 1-3(PIP1-3)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q9SXF8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEGKEEDVRLGANRYTERQPIGTAAQGAEEKDYREPPAAPVFEVEELTSWSFYRAGIAEF VATFLFLYISILTVMGVNKSASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT FGLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGL GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR SLGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPFKSRD
Protein Names:Recommended name: Aquaporin PIP 1-3 Alternative name(s): OsPIP1;3 Plasma membrane intrinsic protein 1-3 Water channel protein RWC3 Short name= RWC-3
Gene Names:Name:PIP1-3 Synonyms:RWC3 Ordered Locus Names:Os02g0823100, LOC_Os02g57720 ORF Names:OJ1136_C04.6, OsJ_008613
Expression Region:1-288
Sequence Info:fµLl length protein
Référence interne:
CSB-CF866014OFG
URL de site web:
/shop/csb-cf866014ofg-elisa-recombinant-oryza-sativa-subsp-japonica-aquaporin-pip-1-3-pip1-3-148413
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.