Skip to Content

ELISA Recombinant Salmonella paratyphi A Hemolysin E(hlyE)

https://assay.labm.com/web/image/product.template/155654/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella paratyphi A (strain ATCC 9150 / SARB42) Uniprot NO.:Q93RR6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TGIFAEQTVEVVKSAIETADGALDFYNKYLDQVIPWKTFDETIKELSRFKQEYSQEASVL VGDIKVLLMDSQDKYFEATQTVYEWCGVVTQLLSAYILLFDEYNEKKASAQKDILIRILD DGVNKLNEAQKSLLGSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDRIRKEAYAGA AAGIVAGPFGLIISYSIAAGVIEGKLIPELNDRLKAVQNFFTSLSVTVKQANKDIDAAKL KLATEIAAIGEIKTETETTRFYVDYDDLmLSLLKGAAKKMINTCNEYQQRHGKKTLLEVP DI Protein Names:Recommended name: Hemolysin E Alternative name(s): Cytotoxin ClyA Silent hemolysin SheA Gene Names:Name:hlyE Synonyms:clyA, sheA Ordered Locus Names:SPA1306 Expression Region:2-303 Sequence Info:fµLl length protein

1,654.00 € 1654.0 EUR 1,654.00 € Tax Excluded

1,654.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF821938SBM
Website URL: /shop/csb-cf821938sbm-elisa-recombinant-salmonella-paratyphi-a-hemolysin-e-hlye-155654

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.