ELISA Recombinant Salmonella paratyphi A Hemolysin E(hlyE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Uniprot NO.:Q93RR6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TGIFAEQTVEVVKSAIETADGALDFYNKYLDQVIPWKTFDETIKELSRFKQEYSQEASVL VGDIKVLLMDSQDKYFEATQTVYEWCGVVTQLLSAYILLFDEYNEKKASAQKDILIRILD DGVNKLNEAQKSLLGSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDRIRKEAYAGA AAGIVAGPFGLIISYSIAAGVIEGKLIPELNDRLKAVQNFFTSLSVTVKQANKDIDAAKL KLATEIAAIGEIKTETETTRFYVDYDDLmLSLLKGAAKKMINTCNEYQQRHGKKTLLEVP DI
Protein Names:Recommended name: Hemolysin E Alternative name(s): Cytotoxin ClyA Silent hemolysin SheA
Gene Names:Name:hlyE Synonyms:clyA, sheA Ordered Locus Names:SPA1306
Expression Region:2-303
Sequence Info:fµLl length protein
This content will be shared across all product pages.
Référence interne:
CSB-CF821938SBM
URL de site web:
/shop/csb-cf821938sbm-elisa-recombinant-salmonella-paratyphi-a-hemolysin-e-hlye-155654
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.