Skip to Content

ELISA Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-A(slc25a25a)

https://assay.labm.com/web/image/product.template/123388/image_1920?unique=c41145e
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Danio rerio (Zebrafish) (Brachydanio rerio) Uniprot NO.:Q6NYZ6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLCLCLYVPVHNSDQIEVEYFESNGLPSELKSLKSLSVLLPSQEFSTYRRWRKKSLKTEE KEHDGQLDFEEFVHYLQDHEKDLKLVFKSMDRKIAGQVNANDIVNSLRDLGVHISLKQAE KVLKSMDKNGTMTIDWNEWKKYPTLQPAENIPEIILYWKHSTIFDVGESLMVPDEFTVEE HLTGMWWRHLVSGGGAGAVSRTCTAPLDRLKVLMQVHGCQGKSMCLMSGLTQMIKEGGVR SLWRGNGINVIKIAPETALKFMAYEQIKRVMGSSQETLGISERFVAGSLAGVIAQSTIYP MEVLKTRLALRKTGQYKGISDCAKHILKTEGMSAFYKGYVPNmLGIIPYAGIDLAVYETL KNTWLQRYGTENADPGVFVLLACGTVSSTCGQLASYPLALIRTRMQAQASVEGSSQVSMT GLFKQIMKTEGPTGLYRGLTPNFLKVIPAVSISYVVYEHIKSTLGVRSR Protein Names:Recommended name: Calcium-binding mitochondrial carrier protein SCaMC-2-A Alternative name(s): Small calcium-binding mitochondrial carrier protein 2-A Solute carrier family 25 member 25-A Gene Names:Name:slc25a25a Synonyms:scamc2a, slc25a25 ORF Names:zgc:77454 Expression Region:1-469 Sequence Info:fµLl length protein

1,830.00 € 1830.0 EUR 1,830.00 € Tax Excluded

1,830.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF747380DIL
Website URL: /shop/csb-cf747380dil-elisa-recombinant-danio-rerio-calcium-binding-mitochondrial-carrier-protein-scamc-2-a-slc25a25a-123388

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.