Se rendre au contenu

ELISA Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-A(slc25a25a)

https://assay.labm.com/web/image/product.template/123388/image_1920?unique=c41145e
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Danio rerio (Zebrafish) (Brachydanio rerio) Uniprot NO.:Q6NYZ6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLCLCLYVPVHNSDQIEVEYFESNGLPSELKSLKSLSVLLPSQEFSTYRRWRKKSLKTEE KEHDGQLDFEEFVHYLQDHEKDLKLVFKSMDRKIAGQVNANDIVNSLRDLGVHISLKQAE KVLKSMDKNGTMTIDWNEWKKYPTLQPAENIPEIILYWKHSTIFDVGESLMVPDEFTVEE HLTGMWWRHLVSGGGAGAVSRTCTAPLDRLKVLMQVHGCQGKSMCLMSGLTQMIKEGGVR SLWRGNGINVIKIAPETALKFMAYEQIKRVMGSSQETLGISERFVAGSLAGVIAQSTIYP MEVLKTRLALRKTGQYKGISDCAKHILKTEGMSAFYKGYVPNmLGIIPYAGIDLAVYETL KNTWLQRYGTENADPGVFVLLACGTVSSTCGQLASYPLALIRTRMQAQASVEGSSQVSMT GLFKQIMKTEGPTGLYRGLTPNFLKVIPAVSISYVVYEHIKSTLGVRSR Protein Names:Recommended name: Calcium-binding mitochondrial carrier protein SCaMC-2-A Alternative name(s): Small calcium-binding mitochondrial carrier protein 2-A Solute carrier family 25 member 25-A Gene Names:Name:slc25a25a Synonyms:scamc2a, slc25a25 ORF Names:zgc:77454 Expression Region:1-469 Sequence Info:fµLl length protein

1.830,00 € 1830.0 EUR 1.830,00 € Hors taxes

1.830,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF747380DIL
URL de site web: /shop/csb-cf747380dil-elisa-recombinant-danio-rerio-calcium-binding-mitochondrial-carrier-protein-scamc-2-a-slc25a25a-123388

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.