Skip to Content

ELISA Recombinant Candida glabrata Dihydroorotate dehydrogenase (quinone), mitochondrial(URA9)

https://assay.labm.com/web/image/product.template/121439/image_1920?unique=7485b17
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (TorµLopsis glabrata) Uniprot NO.:Q6SZS5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QVLKSSFMGLKPLQLTALLLAGSAGYLYFMNARSAIHEYVVCPVVRLITPDPENGHKLGI WCFKWGLSPKLYFDKDPESLHVNVFGTTMTNPIGCAAGLDKDAEAIDGIMPTGFGYMEVG SVTPVAQPGNPRPRFFRLPADDAVINRYGFNSSGHDVVYNNLMKRVNKFLNSYFGDKSID KLSLYKDKLLAVNLGKNKNGDEVKDYLKGVEKFQSLADVLVINVSSPNTPGLRDLQNEAK LTNLLSEIITKRDSQSNKPNALGKQNHKPPVLVKIAPDLTEPELQSIVEAAKKSKVDGII VSNTTIQRPNTLKTQDETLRNQVGGLSGKPLKPFALKAMKAVSKYAKDSDLVLVGCGGIS SGKDAIEFAKAGATFVQLYTSYAYVGPALIARIKDEVAEELKKEGKTWMEIIGEDNK Protein Names:Recommended name: Dihydroorotate dehydrogenase (quinone), mitochondrial Short name= DHOD Short name= DHODase Short name= DHOdehase EC= 1.3.5.2 Alternative name(s): Dihydroorotate oxidase Gene Names:Name:URA9 Ordered Locus Names:CAGL0M12881g Expression Region:23-439 Sequence Info:fµLl length protein

1,775.00 € 1775.0 EUR 1,775.00 € Tax Excluded

1,775.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF740873CZI
Website URL: /shop/csb-cf740873czi-elisa-recombinant-candida-glabrata-dihydroorotate-dehydrogenase-quinone-mitochondrial-ura9-121439

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.