Se rendre au contenu

ELISA Recombinant Candida glabrata Dihydroorotate dehydrogenase (quinone), mitochondrial(URA9)

https://assay.labm.com/web/image/product.template/121439/image_1920?unique=7485b17
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (TorµLopsis glabrata) Uniprot NO.:Q6SZS5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QVLKSSFMGLKPLQLTALLLAGSAGYLYFMNARSAIHEYVVCPVVRLITPDPENGHKLGI WCFKWGLSPKLYFDKDPESLHVNVFGTTMTNPIGCAAGLDKDAEAIDGIMPTGFGYMEVG SVTPVAQPGNPRPRFFRLPADDAVINRYGFNSSGHDVVYNNLMKRVNKFLNSYFGDKSID KLSLYKDKLLAVNLGKNKNGDEVKDYLKGVEKFQSLADVLVINVSSPNTPGLRDLQNEAK LTNLLSEIITKRDSQSNKPNALGKQNHKPPVLVKIAPDLTEPELQSIVEAAKKSKVDGII VSNTTIQRPNTLKTQDETLRNQVGGLSGKPLKPFALKAMKAVSKYAKDSDLVLVGCGGIS SGKDAIEFAKAGATFVQLYTSYAYVGPALIARIKDEVAEELKKEGKTWMEIIGEDNK Protein Names:Recommended name: Dihydroorotate dehydrogenase (quinone), mitochondrial Short name= DHOD Short name= DHODase Short name= DHOdehase EC= 1.3.5.2 Alternative name(s): Dihydroorotate oxidase Gene Names:Name:URA9 Ordered Locus Names:CAGL0M12881g Expression Region:23-439 Sequence Info:fµLl length protein

1.775,00 € 1775.0 EUR 1.775,00 € Hors taxes

1.775,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF740873CZI
URL de site web: /shop/csb-cf740873czi-elisa-recombinant-candida-glabrata-dihydroorotate-dehydrogenase-quinone-mitochondrial-ura9-121439

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.