ELISA Recombinant Bdellovibrio bacteriovorus Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)
Uniprot NO.:Q3V7R3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRSRWQTLRKWIVKAVLLFFVSSLGFVLLYRFVPVPLTPLMVIRSVSSVWGEEFVGIHKD WVPLEEIAPSVQKAVLKAEDYRFFEHNGFDFDAIEKAMKYNKTHKRKKGASTITQQTAKN VFLWPQRDWVRKGLEAYFTILIESTWPKERIMEVYLNVIELGPGVYGVEAASQKYFKRSA KNLNPYQASLIAAVLPNPRRFRIDRPSNYVVGRQRRILNRVAPAIPKAADASLLDFLDLK FDSEEDESAN
Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.-
Gene Names:Name:mtgA Ordered Locus Names:Bd2847
Expression Region:1-250
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF662428BFP
Website URL:
/shop/csb-cf662428bfp-elisa-recombinant-bdellovibrio-bacteriovorus-monofunctional-biosynthetic-peptidoglycan-transglycosylase-mtga-119121
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.