Skip to Content

ELISA Recombinant Bdellovibrio bacteriovorus Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

https://assay.labm.com/web/image/product.template/119121/image_1920?unique=5f2a55b
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) Uniprot NO.:Q3V7R3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSRWQTLRKWIVKAVLLFFVSSLGFVLLYRFVPVPLTPLMVIRSVSSVWGEEFVGIHKD WVPLEEIAPSVQKAVLKAEDYRFFEHNGFDFDAIEKAMKYNKTHKRKKGASTITQQTAKN VFLWPQRDWVRKGLEAYFTILIESTWPKERIMEVYLNVIELGPGVYGVEAASQKYFKRSA KNLNPYQASLIAAVLPNPRRFRIDRPSNYVVGRQRRILNRVAPAIPKAADASLLDFLDLK FDSEEDESAN Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.- Gene Names:Name:mtgA Ordered Locus Names:Bd2847 Expression Region:1-250 Sequence Info:fµLl length protein

1,599.00 € 1599.0 EUR 1,599.00 € Tax Excluded

1,599.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF662428BFP
Website URL: /shop/csb-cf662428bfp-elisa-recombinant-bdellovibrio-bacteriovorus-monofunctional-biosynthetic-peptidoglycan-transglycosylase-mtga-119121

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.