ELISA Recombinant Bdellovibrio bacteriovorus Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) Uniprot NO.:Q3V7R3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSRWQTLRKWIVKAVLLFFVSSLGFVLLYRFVPVPLTPLMVIRSVSSVWGEEFVGIHKD WVPLEEIAPSVQKAVLKAEDYRFFEHNGFDFDAIEKAMKYNKTHKRKKGASTITQQTAKN VFLWPQRDWVRKGLEAYFTILIESTWPKERIMEVYLNVIELGPGVYGVEAASQKYFKRSA KNLNPYQASLIAAVLPNPRRFRIDRPSNYVVGRQRRILNRVAPAIPKAADASLLDFLDLK FDSEEDESAN Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.- Gene Names:Name:mtgA Ordered Locus Names:Bd2847 Expression Region:1-250 Sequence Info:fµLl length protein