ELISA Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET13(SWEET13)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q2QR07
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAmLW IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEELPVV VNVGKLAAATPDRSTGAVHVHPVPRSCAAEAAAAEPEVLVDIPPPPPPRAVEVAAV
Protein Names:Recommended name: Bidirectional sµgar transporter SWEET13 Short name= OsSWEET13
Gene Names:Name:SWEET13 Ordered Locus Names:Os12g0476200, LOC_Os12g29220 ORF Names:OsJ_36063
Expression Region:1-296
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF647713OFG
Website URL:
/shop/csb-cf647713ofg-elisa-recombinant-oryza-sativa-subsp-japonica-bidirectional-sugar-transporter-sweet13-sweet13-148430
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.