ELISA Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET13(SWEET13)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryza sativa subsp. japonica (Rice) Uniprot NO.:Q2QR07 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAmLW IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEELPVV VNVGKLAAATPDRSTGAVHVHPVPRSCAAEAAAAEPEVLVDIPPPPPPRAVEVAAV Protein Names:Recommended name: Bidirectional sµgar transporter SWEET13 Short name= OsSWEET13 Gene Names:Name:SWEET13 Ordered Locus Names:Os12g0476200, LOC_Os12g29220 ORF Names:OsJ_36063 Expression Region:1-296 Sequence Info:fµLl length protein