ELISA Recombinant Drosophila pseudoobscura pseudoobscura Protein KRTCAP2 homolog(GA16263)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila pseudoobscura pseudoobscura (Fruit fly)
Uniprot NO.:Q295N5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVSTSSKNTLLSSIISGILSLVIFATLRFCADWFNGSQLNVLVGGYLFSWLFILSLTCV SNAEmLIFGPDFQAKLVPEILFCLSLTVAAAGIVHRVCATTSVLFSLVGLYFLNRISIKY YSTSVVPVDAPARKTAKKFK
Protein Names:Recommended name: Protein KRTCAP2 homolog
Gene Names:ORF Names:GA16263
Expression Region:1-140
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF641843DME
Website URL:
/shop/csb-cf641843dme-elisa-recombinant-drosophila-pseudoobscura-pseudoobscura-protein-krtcap2-homolog-ga16263-125079
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.