Se rendre au contenu

ELISA Recombinant Drosophila pseudoobscura pseudoobscura Protein KRTCAP2 homolog(GA16263)

https://assay.labm.com/web/image/product.template/125079/image_1920?unique=9fe42c5
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Drosophila pseudoobscura pseudoobscura (Fruit fly) Uniprot NO.:Q295N5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVSTSSKNTLLSSIISGILSLVIFATLRFCADWFNGSQLNVLVGGYLFSWLFILSLTCV SNAEmLIFGPDFQAKLVPEILFCLSLTVAAAGIVHRVCATTSVLFSLVGLYFLNRISIKY YSTSVVPVDAPARKTAKKFK Protein Names:Recommended name: Protein KRTCAP2 homolog Gene Names:ORF Names:GA16263 Expression Region:1-140 Sequence Info:fµLl length protein

1.483,00 € 1483.0 EUR 1.483,00 € Hors taxes

1.483,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF641843DME
URL de site web: /shop/csb-cf641843dme-elisa-recombinant-drosophila-pseudoobscura-pseudoobscura-protein-krtcap2-homolog-ga16263-125079

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.