ELISA Recombinant Reaction center protein L chain(pufL)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Acidiphilium cryptum Uniprot NO.:O66137 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VGPFYVGFFGVTAAFFImLGTALIIWGAALGPTWNIWQISIAPPDLSYGLGLAPLAKGGL WQIITVCAIGAFGSWALREVEISRKLGIGLHVPAAFSVAIFAYVTLEVIRPLLMGAWGNG FPYGIMSHLDWVSNTGYAYLNFEYNPMHMVAVTLFFTTTLALALHGSLVLAAINPPAGET VKFAEHEDTFFRDFIGYSIGTLGIHRLGLFLALGAGFASATCILLSGPFWTQGWPSWWGW WLHLPIWQFGGH Protein Names:Recommended name: Reaction center protein L chain Alternative name(s): Photosynthetic reaction center L subunit Gene Names:Name:pufL Expression Region:1-252 Sequence Info:fµLl length protein