ELISA Recombinant Reaction center protein L chain(pufL)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Acidiphilium cryptum
Uniprot NO.:O66137
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VGPFYVGFFGVTAAFFImLGTALIIWGAALGPTWNIWQISIAPPDLSYGLGLAPLAKGGL WQIITVCAIGAFGSWALREVEISRKLGIGLHVPAAFSVAIFAYVTLEVIRPLLMGAWGNG FPYGIMSHLDWVSNTGYAYLNFEYNPMHMVAVTLFFTTTLALALHGSLVLAAINPPAGET VKFAEHEDTFFRDFIGYSIGTLGIHRLGLFLALGAGFASATCILLSGPFWTQGWPSWWGW WLHLPIWQFGGH
Protein Names:Recommended name: Reaction center protein L chain Alternative name(s): Photosynthetic reaction center L subunit
Gene Names:Name:pufL
Expression Region:1-252
Sequence Info:fµLl length protein
Référence interne:
CSB-CF524670AWD
URL de site web:
/shop/csb-cf524670awd-elisa-recombinant-reaction-center-protein-l-chain-pufl-114254
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.