Skip to Content

ELISA Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit E(mtrE)

https://assay.labm.com/web/image/product.template/143276/image_1920?unique=2109108
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum) Uniprot NO.:O27231 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDPMITGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSG EPVAYGTWCGIAGSVAYVLMQSMQLPVIMAIAVGAVIAAMVHTTYAVTSHMGRIVSQSQF NQPLFMDmLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPGFAHPFPLPLLAVLWGITIGA IGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTG FAFGAIVFLSFWNTIVFGITGGIISGLIIVLLLIILNNRLEVFARNRYGPYKEDE Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit E EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E Gene Names:Name:mtrE Ordered Locus Names:MTH_1163 Expression Region:1-295 Sequence Info:fµLl length protein

1,646.00 € 1646.0 EUR 1,646.00 € Tax Excluded

1,646.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF515974MSR
Website URL: /shop/csb-cf515974msr-elisa-recombinant-methanothermobacter-thermautotrophicus-tetrahydromethanopterin-s-methyltransferase-subunit-e-mtre-143276

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.