Se rendre au contenu

ELISA Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit E(mtrE)

https://assay.labm.com/web/image/product.template/143276/image_1920?unique=2109108
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum) Uniprot NO.:O27231 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDPMITGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSG EPVAYGTWCGIAGSVAYVLMQSMQLPVIMAIAVGAVIAAMVHTTYAVTSHMGRIVSQSQF NQPLFMDmLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPGFAHPFPLPLLAVLWGITIGA IGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTG FAFGAIVFLSFWNTIVFGITGGIISGLIIVLLLIILNNRLEVFARNRYGPYKEDE Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit E EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E Gene Names:Name:mtrE Ordered Locus Names:MTH_1163 Expression Region:1-295 Sequence Info:fµLl length protein

1.646,00 € 1646.0 EUR 1.646,00 € Hors taxes

1.646,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF515974MSR
URL de site web: /shop/csb-cf515974msr-elisa-recombinant-methanothermobacter-thermautotrophicus-tetrahydromethanopterin-s-methyltransferase-subunit-e-mtre-143276

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.