ELISA Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit E(mtrE)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Uniprot NO.:O27231
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDPMITGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSG EPVAYGTWCGIAGSVAYVLMQSMQLPVIMAIAVGAVIAAMVHTTYAVTSHMGRIVSQSQF NQPLFMDmLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPGFAHPFPLPLLAVLWGITIGA IGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTG FAFGAIVFLSFWNTIVFGITGGIISGLIIVLLLIILNNRLEVFARNRYGPYKEDE
Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit E EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E
Gene Names:Name:mtrE Ordered Locus Names:MTH_1163
Expression Region:1-295
Sequence Info:fµLl length protein
Référence interne:
CSB-CF515974MSR
URL de site web:
/shop/csb-cf515974msr-elisa-recombinant-methanothermobacter-thermautotrophicus-tetrahydromethanopterin-s-methyltransferase-subunit-e-mtre-143276
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.