ELISA Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (AFE_0667)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270)) Uniprot NO.:B7J5W3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLLTDFLPIILFFVAYRIHGIYTATEVLIVAAILLMAWQWWRRGRVETMTWVSTLLILT FGGLTLYFHNDTFIKIKPSILYVLFAAALLFTHWREEPLLQRLMGGQLPAALPLSFWRRL NGYWIAFFLFGAVLNLIVAYAFSTGIWVDFKLFGmLAITVIFVLFQAVVISRALPQEAKD GDSSA Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:AFE_0667 Expression Region:1-185 Sequence Info:fµLl length protein