ELISA Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (AFE_0667)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270))
Uniprot NO.:B7J5W3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKLLTDFLPIILFFVAYRIHGIYTATEVLIVAAILLMAWQWWRRGRVETMTWVSTLLILT FGGLTLYFHNDTFIKIKPSILYVLFAAALLFTHWREEPLLQRLMGGQLPAALPLSFWRRL NGYWIAFFLFGAVLNLIVAYAFSTGIWVDFKLFGmLAITVIFVLFQAVVISRALPQEAKD GDSSA
Protein Names:Recommended name: Probable intracellµLar septation protein A
Gene Names:Ordered Locus Names:AFE_0667
Expression Region:1-185
Sequence Info:fµLl length protein
Référence interne:
CSB-CF476518AWH
URL de site web:
/shop/csb-cf476518awh-elisa-recombinant-acidithiobacillus-ferrooxidans-probable-intracellular-septation-protein-a-afe-0667-115343
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.