ELISA Recombinant ER lumen protein retaining receptor(erd-2)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:P48583
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLFRFTADVAHAIAIVVLLLKIWKSRSCEGISGRSQLLFALVFVTRYLDLFTNFFSFYN TAMKIFYLVASFGTVYLMWAKFKATYDRNNDSFRIEFLVIPSMILALLINHEFIFMEVMW TFSIYLEAVAIMPQLFmLSRTGNAETITAHYLFALGSYRFLYILNWVYRYYTESFFDPIS VVAGIVQTVLYADFFYLYITRVIQSNRQFEMSA
Protein Names:Recommended name: ER lumen protein retaining receptor
Gene Names:Name:erd-2 Synonyms:erd2 ORF Names:F09B9.3
Expression Region:1-213
Sequence Info:fµLl length protein
This content will be shared across all product pages.
Internal Reference:
CSB-CF343364CXY
Website URL:
/shop/csb-cf343364cxy-elisa-recombinant-er-lumen-protein-retaining-receptor-erd-2-112927
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.