ELISA Recombinant ER lumen protein retaining receptor(erd-2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Caenorhabditis elegans Uniprot NO.:P48583 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLFRFTADVAHAIAIVVLLLKIWKSRSCEGISGRSQLLFALVFVTRYLDLFTNFFSFYN TAMKIFYLVASFGTVYLMWAKFKATYDRNNDSFRIEFLVIPSMILALLINHEFIFMEVMW TFSIYLEAVAIMPQLFmLSRTGNAETITAHYLFALGSYRFLYILNWVYRYYTESFFDPIS VVAGIVQTVLYADFFYLYITRVIQSNRQFEMSA Protein Names:Recommended name: ER lumen protein retaining receptor Gene Names:Name:erd-2 Synonyms:erd2 ORF Names:F09B9.3 Expression Region:1-213 Sequence Info:fµLl length protein