ELISA Recombinant Cupriavidus necator Probable Ni-Fe-hydrogenase B-type cytochrome subunit(hoxZ)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)
Uniprot NO.:P31898
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTKMQADRIADATGTDEGAVASGKSIKATYVYEAPVRLWHWVNALAIVVLAVTGFFIGS PPATRPGEASANFLMGYIRFAHFVAAYIFAIGmLGRIYWATAGNHHSRELFSVPVFTRAY WQEVISmLRWYAFLSARPSRYVGHNPLARFAMFFIFFLSSVFMILTGFAMYGEGAQMGSW QERMFGWVIPLLGQSQDVHTWHHLGMWFIVVFVIVHVYAAIREDIMGRQSVVSTMVSGYR TFKD
Protein Names:Recommended name: Probable Ni/Fe-hydrogenase B-type cytochrome subunit
Gene Names:Name:hoxZ Ordered Locus Names:PHG003
Expression Region:1-244
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF335676DZQ
Website URL:
/shop/csb-cf335676dzq-elisa-recombinant-cupriavidus-necator-probable-ni-fe-hydrogenase-b-type-cytochrome-subunit-hoxz-123168
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.