ELISA Recombinant Cupriavidus necator Probable Ni-Fe-hydrogenase B-type cytochrome subunit(hoxZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha) Uniprot NO.:P31898 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTKMQADRIADATGTDEGAVASGKSIKATYVYEAPVRLWHWVNALAIVVLAVTGFFIGS PPATRPGEASANFLMGYIRFAHFVAAYIFAIGmLGRIYWATAGNHHSRELFSVPVFTRAY WQEVISmLRWYAFLSARPSRYVGHNPLARFAMFFIFFLSSVFMILTGFAMYGEGAQMGSW QERMFGWVIPLLGQSQDVHTWHHLGMWFIVVFVIVHVYAAIREDIMGRQSVVSTMVSGYR TFKD Protein Names:Recommended name: Probable Ni/Fe-hydrogenase B-type cytochrome subunit Gene Names:Name:hoxZ Ordered Locus Names:PHG003 Expression Region:1-244 Sequence Info:fµLl length protein