ELISA Recombinant Rabbit Synaptophysin-like protein 2(SYPL2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:O62646 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSTESPSRAADKSPRQQVDRLLEGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GAMVRCNNEAKDVSSIIVLFGYPFRLHRIEYEMPLCDDDSSSKTMHLMGDFSAPAEFFVT LGIFSFFYTMAALVVYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH GQGQDQGQGPSQESAAEQGAVEKQ Protein Names:Recommended name: Synaptophysin-like protein 2 Alternative name(s): Mitsµgumin-29 Short name= Mg29 Gene Names:Name:SYPL2 Synonyms:MG29 Expression Region:1-264 Sequence Info:FµLl length protein