ELISA Recombinant Rabbit Synaptophysin-like protein 2(SYPL2)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Oryctolagus cunicµLus (Rabbit)
Uniprot NO.:O62646
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSTESPSRAADKSPRQQVDRLLEGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GAMVRCNNEAKDVSSIIVLFGYPFRLHRIEYEMPLCDDDSSSKTMHLMGDFSAPAEFFVT LGIFSFFYTMAALVVYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH GQGQDQGQGPSQESAAEQGAVEKQ
Protein Names:Recommended name: Synaptophysin-like protein 2 Alternative name(s): Mitsµgumin-29 Short name= Mg29
Gene Names:Name:SYPL2 Synonyms:MG29
Expression Region:1-264
Sequence Info:FµLl length protein
Référence interne:
CSB-CF023026RB
URL de site web:
/shop/csb-cf023026rb-elisa-recombinant-rabbit-synaptophysin-like-protein-2-sypl2-151617
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.