Skip to Content

ELISA Recombinant Listeria welshimeri serovar 6b Cardiolipin synthase(cls)

https://assay.labm.com/web/image/product.template/142197/image_1920?unique=62ab6da
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) Uniprot NO.:A0ALI7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLLAYLLVVLLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPIFGFIIYLIFGRKLSG KKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDSNVKKHRDLIYLLLVNDGAILTQDNE VELFIDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYD AMGSRTTKKSFFRTFEKNGGLVRPFFPSKLPLINFRLNYRNHRKLAIIDGDISYIGGFNI GDEYLGLSKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSASSTNKIDYKPRYFPTFHGKG HTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDV RVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFIHAKTLVVDGEIASVGTANMDF RSFRLNFEVNAFIYEKKMVQKLEDAFLEDILKSYQLTPELYAKRSLWIKFKEAVSRLLSP IL Protein Names:Recommended name: Cardiolipin synthase Short name= CL synthase EC= 2.7.8.- Gene Names:Name:cls Ordered Locus Names:lwe2451 Expression Region:1-482 Sequence Info:fµLl length protein

1,844.00 € 1844.0 EUR 1,844.00 € Tax Excluded

1,844.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF005985LLT
Website URL: /shop/csb-cf005985llt-elisa-recombinant-listeria-welshimeri-serovar-6b-cardiolipin-synthase-cls-142197

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.