Se rendre au contenu

ELISA Recombinant Listeria welshimeri serovar 6b Cardiolipin synthase(cls)

https://assay.labm.com/web/image/product.template/142197/image_1920?unique=62ab6da
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) Uniprot NO.:A0ALI7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLLAYLLVVLLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPIFGFIIYLIFGRKLSG KKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDSNVKKHRDLIYLLLVNDGAILTQDNE VELFIDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYD AMGSRTTKKSFFRTFEKNGGLVRPFFPSKLPLINFRLNYRNHRKLAIIDGDISYIGGFNI GDEYLGLSKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSASSTNKIDYKPRYFPTFHGKG HTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDV RVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFIHAKTLVVDGEIASVGTANMDF RSFRLNFEVNAFIYEKKMVQKLEDAFLEDILKSYQLTPELYAKRSLWIKFKEAVSRLLSP IL Protein Names:Recommended name: Cardiolipin synthase Short name= CL synthase EC= 2.7.8.- Gene Names:Name:cls Ordered Locus Names:lwe2451 Expression Region:1-482 Sequence Info:fµLl length protein

1.844,00 € 1844.0 EUR 1.844,00 € Hors taxes

1.844,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF005985LLT
URL de site web: /shop/csb-cf005985llt-elisa-recombinant-listeria-welshimeri-serovar-6b-cardiolipin-synthase-cls-142197

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.