Skip to Content

ELISA Recombinant Rat Complement C3(C3) ,partial

https://assay.labm.com/web/image/product.template/152125/image_1920?unique=5e1ca23
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Immunology Uniprot ID: P01026 Gene Names: C3 Organism: Rattus norvegicus (Rat) AA Sequence: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL Expression Region: 671-746aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 11 kDa Alternative Name(s): Neutrophil chemotactic factor-2 Relevance: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Reference: "Complement component C3-derived neutrophil chemotactic factors purified from exudate of rat carrageenin-induced inflammation."Nakagawa H., Komorita N.Biochem. Biophys. Res. Commun. 194:1181-1187(1993) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

904.00 € 904.0 EUR 904.00 € Tax Excluded

904.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-YP360475RA
Website URL: /shop/csb-yp360475ra-elisa-recombinant-rat-complement-c3-c3-partial-152125

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.