ELISA Recombinant Rat Complement C3(C3) ,partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Immunology
Uniprot ID: P01026
Gene Names: C3
Organism: Rattus norvegicus (Rat)
AA Sequence: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL
Expression Region: 671-746aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 11 kDa
Alternative Name(s): Neutrophil chemotactic factor-2
Relevance: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.
Reference: "Complement component C3-derived neutrophil chemotactic factors purified from exudate of rat carrageenin-induced inflammation."Nakagawa H., Komorita N.Biochem. Biophys. Res. Commun. 194:1181-1187(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
This content will be shared across all product pages.
Internal Reference:
CSB-YP360475RA
Website URL:
/shop/csb-yp360475ra-elisa-recombinant-rat-complement-c3-c3-partial-152125
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.