ELISA Recombinant CD70 antigen(CD70),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cancer
Uniprot ID: P32970
Gene Names: CD70
Organism: Homo sapiens ()
AA Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Expression Region: 39-193
Sequence Info: ExtracellµLar Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 19.1 kDa
Alternative Name(s): CD27 ligand ;CD27-LTumor necrosis factor ligand superfamily member 7; CD70
Relevance: Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimµLated T-cells and enhances the generation of cytolytic T-cells.
Reference: MolecµLar and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor.Goodwin R.G., Alderson M.R., Smith C.A., Armitage R.J., Vandenbos T., Jerzy R., Toµgh T.W., Schoenborn M.A., David-Smith T., Hennen K., Falk B., Cosman D., Baker E., Sutherland G.R., Grabstein K.H., Farrah T., Giri J.G., Beckmann M.P.Cell 73:447-456(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-YP004954HU
Website URL:
/shop/csb-yp004954hu-elisa-recombinant-cd70-antigen-cd70-partial-130939
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.