ELISA Recombinant Rhodopsin(RHO),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Signal Transduction Uniprot ID:O18766 Gene Names:RHO Organism:Sus scrofa (Pig) AA Sequence:MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ Expression Region:1-36aa Sequence Info:Partial Source:Mammalian cell Tag Info:N-terminal GST-tagged and C-terminal 6xHis-tagged MW:34.2 kDa Alternative Name(s):RHO1 Relevance:Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling Reference:"Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551(2011) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth Involvement in disease: SubcellµLar Location:Membrane, MµLti-pass membrane protein, Cell projection, cilium, photoreceptor outer segment Protein Families:G-protein coupled receptor 1 family, Opsin subfamily Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Ssc&CID=16150 KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ssc:397437 STRING Database Link:https://string-db.org/network/9823.ENSSSCP00000012353 OMIM Database Link: Lead Time Guidance:18-28 business days