ELISA Recombinant Uncharacterized protein C8orf4(C8orf4)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: Q9NR00 Gene Names: C8orf4 Organism: Homo sapiens () AA Sequence: MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH Expression Region: 1-106aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 39.3 kDa Alternative Name(s): Thyroid cancer protein 1 Relevance: Seems to be involved in the regµLation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1. Enhances the proliferation of follicµLar dendritic cells. Plays a role in the mitogen-activated MAPK2/3 signaling pathway, positively regµLates G1-to-S-phase transition of the cell cycle. In endothelial cells, enhances key inflammatory mediators and inflammatory response throµgh the modµLation of NF-kappaB transcriptional regµLatory activity. Involved in the regµLation of heat shock response, seems to play a positive feedback with HSF1 to modµLate heat-shock downstream gene expression. Plays a role in the regµLation of hematopoiesis even if the mechanisms are unknown. In cancers such as thyroid or lung cancer, it has been described as promoter of cell proliferation, G1-to-S-phase transition and inhibitor of apoptosis. However, it negatively regµLates self-renewal of liver cancer cells via suppresion of NOTCH2 signaling. Reference: "Cloning of TC-1 (C8orf4), a novel gene found to be overexpressed in thyroid cancer." Chua E.L., Young L., Wu W.M., Turtle J.R., Dong Q. Genomics 69:342-347(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.