ELISA Recombinant Dog C-C motif chemokine 17(CCL17)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Immunology Uniprot ID:Q95N01 Gene Names:CCL17 Organism:Canis familiaris (Dog) (Canis lupus familiaris) AA Sequence:ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES Expression Region:24-99aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 6xHis-KSI-tagged MW:23.9 kDa Alternative Name(s):CC chemokine TARC;Small-inducible cytokine A17;Thymus and activation-regµLated chemokine Relevance:Chemotactic factor for t lymphocytes but not monocytes or granµLocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8 (By similarity). Reference:"MolecµLar cloning of canine thymus and activation-regµLated chemokine (TARC) gene and its expression in various tissues." Maeda S., Mizuno T., Yamashita K., Kurata K., Masuda K., Ohno K., Tsujimoto H. J. Vet. Med. Sci. 63:1035-1038(2001) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days