ELISA Recombinant Hepatitis B virus genotype D Protein X(X)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: O93195 Gene Names: X Organism: Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D) AA Sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA Expression Region: 1-154aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 32.7 kDa Alternative Name(s): HBx Peptide X pX Relevance: MµLtifunctional protein that may modµLate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellµLar carcinoma). Most of cytosolic activities involve modµLation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to DDB1, may affect cell viability and stimµLate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modµLate apoptosis by binding CFLAR, a key regµLator of the death-inducing signaling complex (DISC). Moderately stimµLates transcription of many different viral and cellµLar transcription elements. Promoters and enhancers stimµLated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1 (By similarity). Reference: "Analysis of hepatitis B virus popµLations in an interferon-alpha-treated patient reveals predominant mutations in the C-gene and changing e-antigenicity."Gunther S., PaµLij W., Meisel H., Will H.Virology 244:146-160(1998) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.