Skip to Content

ELISA Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31

https://assay.labm.com/web/image/product.template/120779/image_1920?unique=7485b17
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P60615 Gene Names: N/A Organism: Bungarus mµLticinctus (Many-banded krait) AA Sequence: IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG Expression Region: 22-95aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged MW: 38 kDa Alternative Name(s): Short name: Alpha-BTX A31 Short name: Alpha-Bgt(A31) Short name: BGTX A31 Alternative name(s): Long neurotoxin 1 Relevance: Binds with high affinity to muscµLar (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscµLar and neuronal transmission. Blocks the extracellµLar increase of dopamine evoked by nicotine only at the higher dose (4.2 µM). Reference: "Genetic organization of alpha-bungarotoxins from Bungarus mµLticinctus (Taiwan banded krait): evidence showing that the production of alpha-bungarotoxin isotoxins is not derived from edited mRNAs." Chang L.-S., Lin S.-K., Huang H.-B., Hsiao M. Nucleic Acids Res. 27:3970-3975(1999) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 € Tax Excluded

1,066.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-EP350255BXN
Website URL: /shop/csb-ep350255bxn-elisa-recombinant-bungarus-multicinctus-alpha-bungarotoxin-isoform-a31-120779

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.