ELISA Recombinant Enterobacteria phage M13 (Bacteriophage M13) Tail virion protein G9P

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Microbiology Uniprot ID: P69538 Gene Names: IX Organism: Enterobacteria phage M13 (Bacteriophage M13) AA Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS Expression Region: 1-32aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 19.7 kDa Alternative Name(s): Coat protein C, polypeptide II G9P Relevance: May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host. Reference: "Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., HµLsebos T.J.M., Schoenmakers J.G.G.Gene 11:129-148(1980) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.