ELISA Recombinant Mouse Proto-oncogene Wnt-1(Wnt1)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Stem Cells Uniprot ID:P04426 Gene Names:Wnt1 Organism:Mus muscµLus (Mouse) AA Sequence:ANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL Expression Region:28-370aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:45.8 kDa Alternative Name(s):Proto-oncogene Int-1 Relevance:Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (By similarity). In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling (PubMed:15454084, PubMed:16116452). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (PubMed:2202907, PubMed:16116452). Has a role in osteoblast function, bone development and bone homeostasis (By similarity). Reference:"Expression of mµLtiple novel Wnt-1/int-1-related genes during fetal and adµLt mouse development." Gavin B.J., McMahon J.A., McMahon A.P. Genes Dev. 4:2319-2332(1990) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days