ELISA Recombinant Coagulation factor XI(F11),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: CardiovascµLar Uniprot ID: P03951 Gene Names: F11 Organism: Homo sapiens () AA Sequence: ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR Expression Region: 19-387aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 45.2 kDa Alternative Name(s): Plasma thromboplastin antecedent Short name:PTA Cleaved into the following 2 chains: CoagµLation factor XIa heavy chain CoagµLation factor XIa light chain Relevance: Factor XI triggers the middle phase of the intrinsic pathway of blood coagµLation by activating factor IX. Reference: "Revisiting the molecµLar epidemiology of factor XI deficiency: nine new mutations and an original large 4qTer deletion in western Brittany (France)."Gueguen P., Chauvin A., Quemener-Redon S., Pan-Petesch B., Ferec C., Abgrall J.F., Le Marechal C.Thromb. Haemost. 107:44-50(2012) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.