Skip to Content

ELISA Recombinant Goat Beta-3 adrenergic receptor(ADRB3)

https://assay.labm.com/web/image/product.template/127938/image_1920?unique=4552294
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Capra hircus (Goat) Uniprot NO.:Q9XT57 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPWPPRNSSLTPWPDIPTLAPNTANASGLPGVPWAVALAGALLALAVLAIVGGNLLVIV AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGHWPLGVTGCELWTSVDVLC VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV GADAEAQRCHSNPRCCTFASNMPYALLSSSVSFYLPLLVmLFVYARVFVVATRQLRLLRR ELGRFPPEESPPAPSRSGSPGPAGPYASPAGVPSYGRRPARLLPLREHRALRTLGLIMGT FTLCWLPFFVVNVVRALGGPSLVSGPTFLALNWLGYANSAFNPLIYCRSPDFQSAFRRLL CRCRPEEHLAAASPPRAPSGAPRVLTSPAGPRQPSPLDGASCGLS Protein Names:Recommended name: Beta-3 adrenergic receptor Alternative name(s): Beta-3 adrenoreceptor Short name= Beta-3 adrenoceptor Gene Names:Name:ADRB3 Synonyms:B3AR Expression Region:1-405 Sequence Info:fµLl length protein

1,762.00 € 1762.0 EUR 1,762.00 € Tax Excluded

1,762.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF893613GO
Website URL: /shop/csb-cf893613go-elisa-recombinant-goat-beta-3-adrenergic-receptor-adrb3-127938

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.