ELISA Recombinant Lactococcus lactis subsp. lactis Uncharacterized protein YrjE(yrjE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) Uniprot NO.:Q9CEU8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNDNNVIFDQRSDGLNAFFSKIYALMGAGVLVSALVSWIMITFFLDNMTAILQSGSLFFL VLWIIPLVMVVSLQGLAMKNSKMALPIFIGYAAFMGFLISFTLLMYTATDITLAFVTAAA MFFGLSVYGRFTKRNLSAMGKAFGVAVWGLIIAMFLNFFFASTGLTILISLVGVVIFAGL IAWDNQKITQVYNANNGQVSDGWAISMALSLYLDFINMFLFLLRLFGIAGGNRD Protein Names:Recommended name: Uncharacterized protein YrjE Gene Names:Name:yrjE Ordered Locus Names:LL1736 ORF Names:L177346 Expression Region:1-234 Sequence Info:fµLl length protein